PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004516496.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 181aa    MW: 21125.2 Da    PI: 8.1047
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004516496.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like73.82.3e-23118167252
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                      r  Wt++LH++Fv +v++L G+e+A Pk+il++m+v+gLt+ehv+SHLQ 
  XP_004516496.1 118 FRWSWTQQLHNQFVTVVNEL-GIENAKPKKILKIMDVPGLTREHVASHLQT 167
                     5899****************.*****************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23009.6E-63992No hitNo description
SuperFamilySSF521725.14E-54087IPR011006CheY-like superfamily
SuperFamilySSF466895.02E-15116170IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.7E-23116167IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-19118169IPR006447Myb domain, plants
PfamPF002494.9E-6121167IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MALTILPERF PIGLRVLALD VDTTHHPILH AMGNRFQYQV MSSHYSTNSV MEAITKGASD  60
YWIKPLEERH FQTMWKHVVK DIFHMNNKRG REQVDVPKQT IDENHNHNDD YPSPAKKFRW  120
SWTQQLHNQF VTVVNELGIE NAKPKKILKI MDVPGLTREH VASHLQTIYL LHSLELVDSN  180
L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004516496.11e-134PREDICTED: two-component response regulator ARR10-like isoform X2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31920.12e-25response regulator 10